PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc02173.1.g00010.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 178aa    MW: 20062.9 Da    PI: 8.5048
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc02173.1.g00010.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like65.31.1e-20130178150
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHL 50 
                                   k rl Wt +LH++F+ av++L G ekA+Pk+ile+m+vk L +e+v+SHL
  Zjn_sc02173.1.g00010.1.sm.mk 130 KSRLSWTRQLHHQFITAVDSL-GVEKAVPKKILEVMNVKHLRREQVASHL 178
                                   68*******************.***************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011012.201164IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521721.42E-91075IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.7E-102579No hitNo description
PROSITE profilePS512949.185127178IPR017930Myb domain
SuperFamilySSF466894.12E-12128178IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-20129178IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-18130178IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MRFICSNLQT VDLIISDAFF PVEDVMSSNG DTGTVMKYIT NGASDFLIKP VRIEELKNIW  60
QHVFRKKIGE ERGKNSNAQH VVDQVFYPPN TAPSPSPARS TGITEASMEL MDSEVREASG  120
TVTDVKDLRK SRLSWTRQLH HQFITAVDSL GVEKAVPKKI LEVMNVKHLR REQVASHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-15129178453ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982951.13e-77PREDICTED: two-component response regulator EHD1-like
SwissprotQ7Y0W32e-62EHD1_ORYSI; Two-component response regulator EHD1
SwissprotQ7Y0W52e-62ORR30_ORYSJ; Two-component response regulator ORR30
TrEMBLK4AM571e-77K4AM57_SETIT; Uncharacterized protein
STRINGSi039992m4e-77(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112222741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.19e-34response regulator 2